Distretto di Zhuqiao Pudong della strada di No.8 Jinshun nuovo, Shanghai, Cina
Casa ProdottiPeptidi iniettabili

Peptidi CJC-1295 della costruzione del muscolo senza DAC per i culturisti

Peptidi CJC-1295 della costruzione del muscolo senza DAC per i culturisti

    • Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders
    • Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders
    • Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders
    • Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders
    • Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders
    • Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders
  • Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders

    Dettagli:

    Luogo di origine: Shanghai
    Marca: FILTER
    Certificazione: GMP
    Numero di modello: Api

    Termini di pagamento e spedizione:

    Quantità di ordine minimo: 10 fiale
    Prezzo: USD 4~8 per vial
    Imballaggi particolari: 2mg, 5mg/vial, 10mg/vial o come richiesto
    Tempi di consegna: Entro 3 giorni lavorativi
    Termini di pagamento: L/C, T/T, , MoneyGram, Payneer
    Capacità di alimentazione: 100,000VIALS/MONTH
    Contatto
    Descrizione di prodotto dettagliata
    Specifica: 2mg/vial Aspetto: polvere bianca
    DeliveryTime: entro 3~7 giorni lavorativi Porto: Shanghai/Shenzhen Hong Kong
    Pacchetto: Icebag, modi discreti dell'imballaggio per il vostro riferimento LimitNum: 10 fiale
    Purezza: 99% Trasporto: DHL, Fedix, HKEMS, HKEUB, TNT
    Storage: posto asciutto, scuro ed arieggiato, (dogree 2~8)
    Evidenziare:

    peptides bodybuilding supplements

    ,

    human growth peptides

    CJC-1295 con DAC

    Nome di prodotto: CJC1295 DAC; CJC1295 con DAC
    Alias: CJC1295 (GHRH/DAC)
    Sequenza: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-LysLys (Maleimidopropionyl) - NH2 (complesso di affinità)
    Densità: 1,45
    CJC-1295 con DAC
    Tipo: Funzione immune AgentsGrade
    Norma: Grado della medicina
    Classificazione: Brassinosteroid
    MF: C165H271N47O46
    Peso molecolare: 3649,30
    Purezza (HPLC): 98,0%
    Aspetto: Polvere bianca
    Singola impurità (HPLC): 1,0%
    Composizione nell'aminoacido: 10% di teorico
    Contenuto del peptide (N%): 80% (da %N)
    Contenuto idrico (Karl Fischer): 6,0%
    Contenuto dell'acetato (HPIC): 15,0%
    Equilibrio di massa: 95.0~105.0%

    Filtro Biotech Co., Ltd. Business Field:

    Come i peptidi e steroidi produttore, siamo per l'OEM per i clienti che hanno requisiti di marche. (Servizio su ordine).
    I nostri servizi della società:

    1. Peptide farmaceutico di Peptide+Bodubuilding
    2. Peptide cosmetico
    3. Polvere, olio e linguette di Sterodis
    4. Servizio su ordine

    Quale scrive i vostri clienti preferisce?

     

    Descrizione
    Nome di prodotto: CJC1295
    Sinonimi: CJC1295; Y (d - A) DAIFTQSYRKVLAQLSARKLLQDILSR-NH2; L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-isoleucyl-L-leucyl-L-seryl-L-arginyl-N6- [3 (2,5-dihydro-2,5-dioxo-1H-pyrrol-1-yl) - 1-oxopropyl] - L-lysinamide; Acetato CJC-1295; CJC1295 con fuori DAC
    CAS: 863288-34-0
    MF: C159H258N46O45
    Mw: 0
    EINECS:  
    Categorie di prodotto: Peptidi


    Il nostro processo:
    Il processo di controllo di qualità
    1) acquistare
    La ricerca di mercato accurata, capisce il prezzo delle materie prime e della prestazione. Alla fonte di acquisizione per capire completamente e completamente per garantire la qualità dell'acquisizione delle materie prime.


    2) Ispezione
    Quattro punti: campionamento, pretrattamento del campione, misurare e elaborazione dei dati.


    3) Produzione
    la a) ogni operatore deve fare l'autoispezione dei producs e prendere nota il registro di controllo corrispondente.
    b) gli ispettori a tempo pieno da parte a parte controllano l'autoispezione dell'operatore e l'esame e firmano dentro l'annotazione corrispondente. L'ispezione a tempo pieno è responsabile di ispezione del prodotto finito e prende nota al prodotto finito il registro di controllo ricevuto.


    4) Prima della vendita
    Il risultato dei test può essere fornito prima della vendita.
    All'istituzione di terzi di rilevazione è permessa se non siete soddisfatto con i risultati dei test.


    I nostri vantaggi:
    1. qualità:
    La nostra società è per molti anni una produzione professionale dei mediatori dell'ormone, i nostri prodotti hanno esportato in Germania, Spagna, Regno Unito, U.S.A., Australia, Medio Oriente, ecc l'altro paese ed abbiamo le risposte molto buone dai nostri clienti, voi possiamo fidarseci di.
    E siamo la manifattura, così nessun problema affinchè noi controlliamo la qualità.
    2. metodo di pagamento: , TT.
    3. servizio: Migliore servizio con servizio di assistenza al cliente a tutti i clienti.
    4. consegna:
    Ordine del campione: Il pacchetto sarà spedito con 3days dopo il pagamento. Possiamo inviarlo via la posta aerea SU, di SME, della HK, DHL o othermethod. Abbiamo una logistica professionale e stabile e possiamo consegnare uniformemente il pacchetto gli intorno 3 - 5 giorni.


    L'altro peptide il nostro rifornimento del laboratorio:

    Prodotto Purezza CAS no.
    Cloridrato del glucagone 98% 16941-32-5
    Acetato di gonadorelina 98% 34973-08-5
    Acetato di Goserelin 98% 145781-92-6
    Acetato (umano) di GRF 98% 83930-13-6
    Acetato di Hexarelin 98% 140703-51-1
    Acetato di Histrelin 98% 76712-82-8
    Acetato di Icatibant 98% 30308-48-4
    Lanreotide 98% 108736-35-2
    Acetato di Lecirelin (Dalmarelin) 98% 61012-19-9
    Leuprolide 98% 74381-53-6
    Acetato di leuprorelina 98% 53714-56-0
    Linaclotide Acatate 98% 851199-59-2
    Lixisenatide 98% 320367-13-3
    Lraglutide 98% 204656-20-2
    Acetato di Lysipressin 98% 50-57-7
    Acetato di Melanotan II 98% 121062-08-6
    MOG (35-55) 98% 163913-87-9
    Acetato di Nafarelin 98% 76932-56-4
    Acetato di Nesiritide (BNP-32) 98% 114471-18-0
    Octreotide 98% 79517-01-4
    Acetato di Ornipressin 98% 3397-23-7
    Acetato dell'ossitocina 98% 50-56-6
    Palmitoyl Pentapeptide 98% 214047-00-4
    Pexiganan 98% 147664-63-9
    Acetato di Pramlintide 98% 196078-30-5
    Pretirelin    
    Acetato PT141 98% 32780-32-8
    Acetato di color salmone della calcitonina 98% 47931-85-1
    Acetato di Secretin 98% 10813-74-8
    Acetato di Sermorelin 98% 86168-78-7
    Sincalide 98% 25126-32-3
    Acetato dell'somatostatina 98% 38916-34-6
    Acetato di Splenopentin 98% 105184-37-0
    Acetato di Taltirelin 98% 103300-74-9
    Acetato di Teriparatide 98% 52232-67-4
    Acetato di Teriparatide 98% 52232-67-4
    Acetato di terlipressina 98% 14636-12-5
    Acetato di Tetracosactide 98% 16960-16-0
    Thymalfasin 98% 62304-98-7
    Thymopentin 98% 69558-55-0
    Acetato di Thymosin α1 98% 14636-12-5
    Acetato di Thymosin β4 (TB-500) 98% 77591-33-4
    Acetato di triptorelina 98% 57773-63-4
    Acetato di Vapreotide 98% 103222-11-3
    Acetato della vasopressina 98% 9034-50-8
    Acetato di Ziconotide 98% 107452-89-1

     

    Laboratorio

    Peptidi CJC-1295 della costruzione del muscolo senza DAC per i culturisti 0

    Politica dei clienti di VIP:
    Se la vostra somma totale d'acquisto nella nostra società all'anno potesse raggiungere 50.000 USD, al di fine d'anno, potremmo usare 2%-5% della somma totale per inviare le merci libere.

    Tipi del cliente che hanno avuti più supporto:
    cliente 1.Potential
    (Con il numero di clienti del mercato di dati di acquisto +Clients e la quantità correnti dei prodotti al mese da applicarsi)

    gruppo del cliente 2.Stable ed ordine stabile di quantità al mese
    (Con i dati di acquisto completi con la nostra società da applicarsi)

    utenti personali 3.Regular
    (Con i dati di acquisto completi con la nostra società da applicarsi)

    4.Clients che hanno fondi ed hanno piano per ampliare il mercato
    (Con il numero di clienti del mercato di dati di acquisto +Clients e la quantità correnti dei prodotti al mese da applicarsi)
    ** Mercato reale corrente di Data+Future (basato sulla corrente)
     

    Dettagli di contatto
    Passion Technology Development Limited

    Persona di contatto: Qin

    Invia la tua richiesta direttamente a noi (0 / 3000)

    Altri prodotti
    Richiedere un preventivo

    E-Mail | Sitemap

    Privacy Policy Porcellana buon qualità Peptidi iniettabili fornitore. © 2018 - 2021 peptide-steroids.com. All Rights Reserved.